제품 > 항체 > 단일클론항체(mAb)

ABflo® 488 Rabbit anti-Human CD71 mAb (A22301)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 SH-SY5Y cells (Low Expression, left) and K-562 cells (right) were surface-stained with ABflo® 488 Rabbit anti-Human CD71 mAb (A22301, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).

Flow cytometry: 1X10^6 K-562 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD71 mAb (A22301, 5 μl/Test, right).

Review

Overview

Product name	ABflo® 488 Rabbit anti-Human CD71 mAb
Catalog No.	A22301
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54394-ABf488

Background

This gene encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis. This receptor is required for erythropoiesis and neurologic development. Multiple alternatively spliced variants have been identified.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human CD71 (NP_003225.2).
Sequence	RLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPV
Gene ID
Swiss Prot
Synonyms	T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46
Calculated MW	85kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type II membrane protein, Melanosome, Secreted (serum form).
Customer validation	(Raji cells) FC(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ABflo® 488 Rabbit anti-Human CD71 mAb images

Flow CytoMetry - ABflo® 488 Rabbit anti-Human CD71 mAb (A22301)

Flow cytometry: 1X10^6 K-562 cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD71 mAb (A22301, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.