제품 > 항체 > 단일클론항체(mAb)

CD71/Transferrin Receptor Rabbit mAb (A22161)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from HeLa cells, using CD71/Transferrin Receptor Rabbit mAb (A22161) at1:80000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - CD71/Transferrin Receptor Rabbit mAb (A22161)

Immunohistochemistry analysis of paraffin-embedded Human lung using CD71/Transferrin Receptor Rabbit mAb (A22161) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - CD71/Transferrin Receptor Rabbit mAb (A22161)

Confocal imaging of HeLa cells using CD71/Transferrin Receptor Rabbit mAb (A22161, dilution 1:200) (Red). The cells were counterstained with CD44 Rabbit mAb (A21919, dilution 1:200) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

Overview

Product name	CD71/Transferrin Receptor Rabbit mAb
Catalog No.	A22161
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54396

Background

This gene encodes a cell surface receptor necessary for cellular iron uptake by the process of receptor-mediated endocytosis. This receptor is required for erythropoiesis and neurologic development. Multiple alternatively spliced variants have been identified.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human CD71/Transferrin Receptor (NP_003225.2).
Sequence	RLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPV
Gene ID
Swiss Prot
Synonyms	T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46
Calculated MW	85kDa
Observed MW	90kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:80000 - 1:480000 IHC-P 1:200 - 1:2000 IF/ICC 1:100 - 1:400 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa
Cellular location	basolateral plasma membrane, blood microparticle, cell surface, clathrin-coated pit, cytoplasmic vesicle, early endosome, endosome, external side of plasma membrane, extracellular exosome, extracellular region, extracellular space, extracellular vesicle, melanosome, mitochondrion, nucleus, perinuclear region of cytoplasm, plasma membrane, recycling endosome.
Customer validation	WB(Homo sapiens) IF(Homo sapiens,Mus musculus) IHC(Homo sapiens,Mus musculus)