Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | ABflo® 488 Rabbit anti-Human PU.1/SPI1 mAb |
---|---|
Catalog No. | A24633 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC63111-ABflo488 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PU.1/SPI1 (NP_003111.2). |
---|---|
Sequence | MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPM |
Gene ID | |
Swiss Prot | |
Synonyms | SPI1; OF; PU.1; SFPI1; SPI-1; SPI-A; Spi-1 proto-oncogene |
Calculated MW | 31kDa |
Observed MW | Refer to figures |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3. |
Key application | |
Positive samples | |
Cellular location | Nucleus |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.