제품 > 항체 > 다중클론항체(pAb)

SPI1 Rabbit pAb (A20461)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates, using SPI1 Rabbit pAb (A20461) at 1:700 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC):Jurkat
Exposure time: 30s.

ABclonal:Immunohistochemistry - SPI1 Rabbit pAb (A20461)

Immunohistochemistry analysis of paraffin-embedded human tonsil using SPI1 Rabbit pAb (A20461) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Overview

Product name	SPI1 Rabbit pAb
Catalog No.	A20461
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes an ETS-domain transcription factor that activates gene expression during myeloid and B-lymphoid cell development. The nuclear protein binds to a purine-rich sequence known as the PU-box found near the promoters of target genes, and regulates their expression in coordination with other transcription factors and cofactors. The protein can also regulate alternative splicing of target genes. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 17-98 of human SPI1 (NP_003111.2).
Sequence	SEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDT
Gene ID
Swiss Prot
Synonyms	OF; PU.1; AGM10; SFPI1; SPI-1; SPI-A; SPI1
Calculated MW	31kDa
Observed MW	42kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	U-937, Mouse spleen
Cellular location	nucleoplasm, nucleus
Customer validation	WB(Mus musculus, Mus musculus ) IF(Mus musculus )