제품 > 항체 > 단일클론항체(mAb)

PU.1/SPI1 Rabbit mAb (A24910)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of various lysates, using PU.1/SPI1 Rabbit mAb (A24910) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC):HAP1
Exposure time: 15s.

ABclonal:Immunohistochemistry - PU.1/SPI1 Rabbit mAb (A24910)

Immunohistochemistry analysis of paraffin-embedded Human appendix tissue using PU.1/SPI1 Rabbit mAb (A24910) at a dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human follicular lymphoma tissue using PU.1/SPI1 Rabbit mAb (A24910) at a dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using PU.1/SPI1 Rabbit mAb (A24910) at a dilution of 1:3000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - PU.1/SPI1 Rabbit mAb (A24910)

Confocal imaging of THP-1 cells using PU.1/SPI1 Rabbit mAb (A24910, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of paraffin-embedded Human spleen tissue using PU.1/SPI1 Rabbit mAb (A24910, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

ABclonal:Flow CytoMetry - PU.1/SPI1 Rabbit mAb (A24910)

Flow cytometry: 1X10^6 HAP1 cells (negative control, left) and THP-1 cells (right) were intracellularly-stained with PU.1/SPI1 Rabbit mAb (A24910, 2 μg/mL, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line), followed by ABflo® 594-conjugated Goat Anti-Rabbit IgG (H+L) staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 THP-1 cells were intracellularly-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or PU.1/SPI1 Rabbit mAb (A24910, 2 μg/mL, right).

Overview

Product name	PU.1/SPI1 Rabbit mAb
Catalog No.	A24910
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63111

Background

This gene encodes an ETS-domain transcription factor that activates gene expression during myeloid and B-lymphoid cell development. The nuclear protein binds to a purine-rich sequence known as the PU-box found near the promoters of target genes, and regulates their expression in coordination with other transcription factors and cofactors. The protein can also regulate alternative splicing of target genes. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PU.1/SPI1 (NP_003111.2)
Sequence	MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPM
Gene ID
Swiss Prot
Synonyms	OF; PU.1; AGM10; SFPI1; SPI-1; SPI-A; PU.1/SPI1
Calculated MW	31kDa
Observed MW	38kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:500 - 1:5000 IF/ICC 1:50 - 1:200 FC (intra) 1:100 - 1:500 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Daudi
Cellular location	nucleoplasm, nucleus.
Customer validation	WB(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구후성유전학 & 핵 신호전달전사 인자

PU.1/SPI1 Rabbit mAb images

Western blot - PU.1/SPI1 Rabbit mAb (A24910)

Immunohistochemistry - PU.1/SPI1 Rabbit mAb (A24910)

Immunofluorescence - PU.1/SPI1 Rabbit mAb (A24910)

Flow CytoMetry - PU.1/SPI1 Rabbit mAb (A24910)

Flow cytometry: 1X10^6 THP-1 cells were intracellularly-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or PU.1/SPI1 Rabbit mAb (A24910, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.