제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Human PU.1/SPI1 mAb (A24635)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 HAP1 cells (negative control, left) and THP-1 cells (right) were intracellularly-stained with ABflo® 594 Rabbit anti-Human PU.1/SPI1 mAb (A24635, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 THP-1 cells were intracellularly-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human PU.1/SPI1 mAb (A24635, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Human PU.1/SPI1 mAb
Catalog No.	A24635
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63111-ABflo594

Background

This gene encodes an ETS-domain transcription factor that activates gene expression during myeloid and B-lymphoid cell development. The nuclear protein binds to a purine-rich sequence known as the PU-box found near the promoters of target genes, and regulates their expression in coordination with other transcription factors and cofactors. The protein can also regulate alternative splicing of target genes. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PU.1/SPI1 (NP_003111.2).
Sequence	MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPM
Gene ID
Swiss Prot
Synonyms	SPI1; OF; PU.1; SFPI1; SPI-1; SPI-A; Spi-1 proto-oncogene
Calculated MW	31kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	Nucleus