Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | ABflo® 594 Rabbit anti-Human LAMP2 mAb |
---|---|
Catalog No. | A24189 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC54767-ABflo594 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 29-375 of human LAMP2 (NP_002285.1). |
---|---|
Sequence | LELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIKYLD |
Gene ID | |
Swiss Prot | |
Synonyms | DND; LAMPB; CD107b; LAMP-2; LGP-96; LGP110 |
Calculated MW | 44kDa/45kDa |
Observed MW |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3. |
Key application | |
Positive samples | |
Cellular location | Cell membrane, Single-pass type I membrane protein, Endosome membrane, Lysosome membrane, Cytoplasmic vesicle, autophagosome membrane, extracellular exosome, extracellular space, late endosome, lysosomal lumen, lysosome, perinuclear region of cytoplasm, plasma membrane, trans-Golgi network. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.