제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Human LAMP2 mAb (A24189)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 knockout (KO) HeLa cells (negative control, left) and HeLa cells (right) were intracellularly-stained with ABflo® 594 Rabbit anti-Human LAMP2 mAb (A24189, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 HeLa cells were intracellularly-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Human LAMP2 mAb (A24189, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Human LAMP2 mAb
Catalog No.	A24189
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC54767-ABflo594

Background

The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 29-375 of human LAMP2 (NP_002285.1).
Sequence	LELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIKYLD
Gene ID
Swiss Prot
Synonyms	DND; LAMPB; CD107b; LAMP-2; LGP-96; LGP110
Calculated MW	44kDa/45kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular location	Cell membrane, Single-pass type I membrane protein, Endosome membrane, Lysosome membrane, Cytoplasmic vesicle, autophagosome membrane, extracellular exosome, extracellular space, late endosome, lysosomal lumen, lysosome, perinuclear region of cytoplasm, plasma membrane, trans-Golgi network