제품 > 항체 > 단일클론항체(mAb)

ABflo® 594 Rabbit anti-Mouse CD252 (OX40 Ligand) mAb (A25747)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Confocal imaging of 293T cells transfected with CD252 (OX40 Ligand) using ABflo® 594 Rabbit anti-Mouse CD252 (OX40 Ligand) mAb (A25747, dilution 1:100) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Flow CytoMetry - ABflo® 594 Rabbit anti-Mouse CD252 (OX40 Ligand) mAb (A25747)

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293T (Transfection, right) cells were surface-stained with ABflo® 594 Rabbit anti-Mouse CD252 (OX40 Ligand) mAb (A25747, 5 μl/Test, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection) cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or ABflo® 594 Rabbit anti-Mouse CD252 (OX40 Ligand) mAb (A25747, 5 μl/Test, right).

Overview

Product name	ABflo® 594 Rabbit anti-Mouse CD252 (OX40 Ligand) mAb
Catalog No.	A25747
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC66508-ABflo594

Background

Enables tumor necrosis factor receptor binding activity. Involved in several processes, including T cell activation; regulation of gene expression; and regulation of lymphocyte activation. Acts upstream of or within cholesterol metabolic process; inflammatory response; and negative regulation of cytokine production. Predicted to be located in cell surface. Predicted to be active in extracellular space. Is expressed in sensory organ and skeleton. Used to study primary pulmonary hypertension and type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in myocardial infarction. Orthologous to human TNFSF4 (TNF superfamily member 4).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 51-198 of mouse CD252 (OX40 Ligand) (NP_033478.1).
Sequence	SSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
Gene ID
Swiss Prot
Synonyms	Ath1; gp34; Ath-1; Ox40l; TXGP1; CD134L; OX-40L; Tnlg2b; Txgp1l
Calculated MW	22kDa
Observed MW

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:200 FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Immunofluorescence Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type II membrane protein.