제품 > 항체 > 단일클론항체(mAb)

CD252 (OX40 Ligand) Rabbit mAb (A25928)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Confocal imaging of 293T cells transfected with CD252 (OX40 Ligand) using CD252 (OX40 Ligand) Rabbit mAb (A25928, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Flow CytoMetry - CD252 (OX40 Ligand) Rabbit mAb (A25928)

Flow cytometry: 1X10^6 293T (negative control, left) and 293T (Transfection, right) cells were surface-stained with CD252 (OX40 Ligand) Rabbit mAb (A25928, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293T (Transfection, right) cells were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or CD252 (OX40 Ligand) Rabbit mAb (A25928, 2 μg/mL, right), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining.

Overview

Product name	CD252 (OX40 Ligand) Rabbit mAb
Catalog No.	A25928
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC66508

Background

Enables tumor necrosis factor receptor binding activity. Involved in several processes, including T cell activation; regulation of gene expression; and regulation of lymphocyte activation. Acts upstream of or within cholesterol metabolic process; inflammatory response; and negative regulation of cytokine production. Predicted to be located in cell surface. Predicted to be active in extracellular space. Is expressed in sensory organ and skeleton. Used to study primary pulmonary hypertension and type 1 diabetes mellitus. Human ortholog(s) of this gene implicated in myocardial infarction. Orthologous to human TNFSF4 (TNF superfamily member 4).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 51-198 of mouse CD252 (OX40 Ligand) (NP_033478.1).
Sequence	SSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
Gene ID
Swiss Prot
Synonyms	Ath1; gp34; Ath-1; Ox40l; TXGP1; CD134L; OX-40L; Tnlg2b; Txgp1l
Calculated MW	22kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:200 - 1:800 FC 1:100 - 1:500 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Immunofluorescence Flow Cytometry
Positive samples
Cellular location	Membrane ; Single-pass type II membrane protein.