제품 > 항체 > 단일클론항체(mAb)

ABflo® 610 Rabbit anti-Human/Monkey CD8a mAb (A25765)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 293F (negative control, left) and Human PBMC (right) were surface-stained with ABflo® 610 Rabbit anti-Human CD8a mAb (A25765, 5 μl/Test, orange line) or ABflo® 610 Rabbit IgG isotype control (5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 Human PBMC were surface-stained with ABflo® 610 Rabbit IgG isotype control (5 μl/Test, left) or ABflo® 610 Rabbit anti-Human CD8a mAb (A25765, 5 μl/Test, right).

Review

Overview

Product name	ABflo® 610 Rabbit anti-Human/Monkey CD8a mAb
Catalog No.	A25765
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC55248-ABflo610

Background

The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain. Multiple transcript variants encoding different isoforms have been found for this gene. The major protein isoforms of this gene differ by the presence or absence of a transmembrane domain and thus differ in being a membrane-anchored or secreted protein.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 22-182 of human CD8a (NP_001759.3).
Sequence	SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
Gene ID
Swiss Prot
Synonyms	CD8; p32; Leu2; CD8alpha
Calculated MW	21kDa/25kDa/30kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Single-pass type I membrane protein, Secreted
Customer validation	(Human PBMCs)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구면역학 & 염증CDs

ABflo® 610 Rabbit anti-Human/Monkey CD8a mAb images

Flow CytoMetry - ABflo® 610 Rabbit anti-Human/Monkey CD8a mAb (A25765)

Flow cytometry: 1X10^6 Human PBMC were surface-stained with ABflo® 610 Rabbit IgG isotype control (5 μl/Test, left) or ABflo® 610 Rabbit anti-Human CD8a mAb (A25765, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.