Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Monkey
Product name | ABflo® 488 Rabbit anti-Human/Monkey CD8a mAb |
---|---|
Catalog No. | A23345 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC55248-ABflo488 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-182 of human CD8A (NP_001759.3). |
---|---|
Sequence | SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD |
Gene ID | |
Swiss Prot | |
Synonyms | CD8; p32; Leu2; CD8alpha |
Calculated MW | 21kDa/25kDa/30kDa |
Observed MW | Refer to figures |
Reactivity | Human, Monkey |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3. |
Key application | Flow Cytometry |
Positive samples | |
Cellular location | Cell membrane, Single-pass type I membrane protein, Secreted. |
Customer validation | (Human PBMC, Human PBMCs) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr