제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Dog CD27 mAb (A22576)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Dog

Flow cytometry:1X10^6 293F cells (negative control, left) and 293F(Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Dog CD27 mAb(A22576, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 293F(Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti- Dog CD27 mAb(A22576, 5 μl/Test, right).

Overview

Product name	ABflo® 647 Rabbit anti-Dog CD27 mAb
Catalog No.	A22576
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC55676-ABf647

Background

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-215 of dog ABflo® 647 Rabbit anti-Dog CD27 (XP_038295140.1).
Sequence	ATPAPKRCPEKHYQVQGERCCQMCKPGTFLVKDCERHGEAAQCDPCIPGASFSPDHHARRHCESCRHCNSGLLIRNCTLTANAECDCPKGWKCRDKQCTECDPPSNPLLIPHPSPARGPHLQPTHLPYAKIKFQATLCPVTGIVRLSPQSPPSPKMQETSTVRQVQTLADFRWLPAPALSTHWPPQRSLCSSDCIR
Gene ID
Swiss Prot
Synonyms	T14; S152; Tp55; TNFRSF7; S152. LPFS2
Calculated MW	31kDa
Observed MW

Applications

Reactivity	Dog
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	External side of plasma membrane