Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Dog
Product name | ABflo® 488 Rabbit anti-Dog CD27 mAb |
---|---|
Catalog No. | A22575 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC55676-ABf488 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-215 of dog CD27 (XP_038295140.1). |
---|---|
Sequence | ATPAPKRCPEKHYQVQGERCCQMCKPGTFLVKDCERHGEAAQCDPCIPGASFSPDHHARRHCESCRHCNSGLLIRNCTLTANAECDCPKGWKCRDKQCTECDPPSNPLLIPHPSPARGPHLQPTHLPYAKIKFQATLCPVTGIVRLSPQSPPSPKMQETSTVRQVQTLADFRWLPAPALSTHWPPQRSLCSSDCIR |
Gene ID | |
Swiss Prot | |
Synonyms | T14; S152; Tp55; TNFRSF7; S152. LPFS2 |
Calculated MW | 31kDa |
Observed MW |
Reactivity | Dog |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3. |
Key application | Flow Cytometry |
Positive samples | |
Cellular location | External side of plasma membrane |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.