제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Human CD9 mAb (A24157)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 CHO (Transfection) cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human CD9 mAb (A24157, 5 μl/Test, right).

Flow cytometry: 1X10^6 CHO cells (negative control, left) and CHO (Transfection, right) cells were surface-stained with ABflo® 647 Rabbit anti-Human CD9 mAb (A24157, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry:1X10^6 Human PBMC were surface-stained with PE/Cyanine7 Mouse anti-Human CD3 mAb (A22798, 5 μl/Test) and ABflo® 647 Rabbit anti-Human CD9 mAb (A24157, 5 μl/Test, right) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left).

Flow cytometry:1X10^6 Human PBMC were surface-stained with PE Mouse anti-Human CD19 mAb (A22816, 5 μl/Test) and ABflo® 647 Rabbit anti-Human CD9 mAb (A24157, 5 μl/Test, right) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left).

Overview

Product name	ABflo® 647 Rabbit anti-Human CD9 mAb
Catalog No.	A24157
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC65639-ABflo647

Background

This gene encodes a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Tetraspanins are cell surface glycoproteins with four transmembrane domains that form multimeric complexes with other cell surface proteins. The encoded protein functions in many cellular processes including differentiation, adhesion, and signal transduction, and expression of this gene plays a critical role in the suppression of cancer cell motility and metastasis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-228 of human CD9(NP_001760.1).
Sequence	MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV
Gene ID
Swiss Prot
Synonyms	MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN29; TSPAN-29
Calculated MW	25kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, Membrane, Multi-pass membrane protein.