제품 > 항체 > 단일클론항체(mAb)

ABflo® 647 Rabbit anti-Human Galectin 3 mAb (A23017)

Datasheet

Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human

ABclonal:Flow CytoMetry - ABflo® 647 Rabbit anti-Human Galectin 3 mAb (A23017)

Flow cytometry:1X10^6 Jurkat cells(Low Expression control, Left) and MCF7 cells (Right) were intracellularly-stained with ABflo® 647 Rabbit anti-Human Galectin 3 mAb(A23017, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).

ABclonal:Flow CytoMetry - ABflo® 647 Rabbit anti-Human Galectin 3 mAb (A23017)

Flow cytometry:1X10^6 MCF7 cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human Galectin 3 mAb(A23017, 5 μl/Test, right).

ABclonal:Flow CytoMetry - ABflo® 647 Rabbit anti-Human Galectin 3 mAb (A23017)

Flow cytometry:1X10^6 Human PBMC were intracellularly-stained with ABflo® 647 Rabbit anti-Human Galectin 3 mAb(A23017, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).

ABclonal:Flow CytoMetry - ABflo® 647 Rabbit anti-Human Galectin 3 mAb (A23017)

Flow cytometry:1X10^6 Human PBMC were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human Galectin 3 mAb(A23017, 5 μl/Test, right).

Overview

Product nameABflo® 647 Rabbit anti-Human Galectin 3 mAb
Catalog No.A23017
Host speciesRabbit
Purification methodAffinity purification
IsotypeIgG
CloneNo.ARC58285-ABf647
This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.
ImmunogenRecombinant protein of human Galectin 3.
Sequence MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Gene ID
Swiss Prot
SynonymsL31; GAL3; MAC2; CBP35; GALBP; GALIG; LGALS2
Calculated MW26kDa
Observed MW
ReactivityHuman
Tested applicationsWBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition
Recommended dilution
  • FC (intra) 5 μl per 10^6 cells in 100 μl volume
Storage bufferStore at 2-8℃. Avoid freeze.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, pH7.3.
Key application
Positive samples
Cellular locationCytoplasm, Nucleus, Secreted

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

ABclonal:Flow CytoMetry - ABflo® 647 Rabbit anti-Human Galectin 3 mAb (A23017)}

Flow CytoMetry - ABflo® 647 Rabbit anti-Human Galectin 3 mAb (A23017)

Flow cytometry:1X10^6 Jurkat cells(Low Expression control, Left) and MCF7 cells (Right) were intracellularly-stained with ABflo® 647 Rabbit anti-Human Galectin 3 mAb(A23017, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).
ABclonal:Flow CytoMetry - ABflo® 647 Rabbit anti-Human Galectin 3 mAb (A23017)}

Flow CytoMetry - ABflo® 647 Rabbit anti-Human Galectin 3 mAb (A23017)

Flow cytometry:1X10^6 MCF7 cells were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human Galectin 3 mAb(A23017, 5 μl/Test, right).
ABclonal:Flow CytoMetry - ABflo® 647 Rabbit anti-Human Galectin 3 mAb (A23017)}

Flow CytoMetry - ABflo® 647 Rabbit anti-Human Galectin 3 mAb (A23017)

Flow cytometry:1X10^6 Human PBMC were intracellularly-stained with ABflo® 647 Rabbit anti-Human Galectin 3 mAb(A23017, 5 μl/Test, orange line) or ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, blue line). Non-fluorescently stained cells were used as blank control (red line).
ABclonal:Flow CytoMetry - ABflo® 647 Rabbit anti-Human Galectin 3 mAb (A23017)}

Flow CytoMetry - ABflo® 647 Rabbit anti-Human Galectin 3 mAb (A23017)

Flow cytometry:1X10^6 Human PBMC were intracellularly-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 5 μl/Test, left) or ABflo® 647 Rabbit anti-Human Galectin 3 mAb(A23017, 5 μl/Test, right).

* For research use only. Not for therapeutic or diagnostic purposes.

항체 (7)

ELISA 키트 (2)

재조합 단백질 (1)

제품 (2)

Secondary Antibodies (26)