Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Galectin 3/LGALS3 Rabbit mAb |
---|---|
Catalog No. | A22442 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2807 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Galectin 3/LGALS3 (P17931). |
---|---|
Sequence | AYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKI |
Gene ID | |
Swiss Prot | |
Synonyms | L31; GAL3; MAC2; CBP35; GALBP; GALIG; LGALS2; Galectin 3/LGALS3 |
Calculated MW | 26kDa |
Observed MW | 28kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Mouse lung, Mouse spleen, Rat lung, Rat spleen, HeLa |
Cellular location | Cytoplasm, Nucleus, Secreted. |
Customer validation | WB(Bos taurus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22442? Please let us know so that we can cite the reference in this datasheet.