제품 > 항체 > 단일클론항체(mAb)

Galectin 3/LGALS3 Rabbit mAb (A22768)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using Galectin 3/LGALS3 Rabbit mAb (A22768) at 1:10000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - Galectin 3/LGALS3 Rabbit mAb (A22768)

Immunofluorescence analysis of HeLa cells using Galectin 3/LGALS3 Rabbit mAb (A22768) at dilution of 1:500 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using Galectin 3/LGALS3 Rabbit mAb (A22768) at dilution of 1:500 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using Galectin 3/LGALS3 Rabbit mAb (A22768) at dilution of 1:500 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - Galectin 3/LGALS3 Rabbit mAb (A22768)

Immunoprecipitation analysis of 300 μg extracts of MCF7 cells using 3 μg Galectin 3/LGALS3 antibody (A22768). Western blot was performed from the immunoprecipitate using Galectin 3/LGALS3 antibody (A22768) at a dilution of 1:1000.

Overview

Product name	Galectin 3/LGALS3 Rabbit mAb
Catalog No.	A22768
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC58277

Background

This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 human Galectin 3/LGALS3 (NP_002297.2).
Sequence	MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Gene ID
Swiss Prot
Synonyms	L31; GAL3; MAC2; CBP35; GALBP; GALIG; LGALS2; Galectin 3/LGALS3
Calculated MW	26kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:10000 - 1:40000 IF/ICC 1:200 - 1:800 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HeLa, Rat spleen, NIH/3T3, C2C12
Cellular location	Cytoplasm, Nucleus, Secreted.
Customer validation	WB(Rattus norvegicus, Homo sapiens)