제품 > 항체 > 단일클론항체(mAb)

Galectin 3/LGALS3 Rabbit mAb (A11198)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

ABclonal:Western blot - Galectin 3/LGALS3 Rabbit mAb (A11198)

Western blot analysis of various lysates using Galectin 3/LGALS3 Rabbit mAb (A11198) at 1：1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - Galectin 3/LGALS3 Rabbit mAb (A11198)

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Galectin 3/LGALS3 Rabbit mAb (A11198) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using Galectin 3/LGALS3 Rabbit mAb (A11198) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Galectin 3/LGALS3 Rabbit mAb (A11198) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Galectin 3/LGALS3 Rabbit mAb (A11198) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using Galectin 3/LGALS3 Rabbit mAb (A11198) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using Galectin 3/LGALS3 Rabbit mAb (A11198) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunoprecipitation - Galectin 3/LGALS3 Rabbit mAb (A11198)

Immunoprecipitation analysis of 300 μg extracts of HT-29 cells using 3 μg Galectin 3/LGALS3 antibody (A11198). Western blot was performed from the immunoprecipitate using Galectin 3/LGALS3 antibody (A11198) at a dilution of 1:1000.

Overview

Product name	Galectin 3/LGALS3 Rabbit mAb
Catalog No.	A11198
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0542

Background

This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Galectin 3/LGALS3 (P17931).
Sequence	MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGA
Gene ID
Swiss Prot
Synonyms	L31; GAL3; MAC2; CBP35; GALBP; GALIG; LGALS2; Galectin 3/LGALS3
Calculated MW	26kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:200 - 1:800 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HT-29, A549, MCF7, RAW 264.7, Mouse lung, Mouse spleen, Rat lung
Cellular location	Cytoplasm, Nucleus, Secreted.
Customer validation	WB(Rattus norvegicus, Homo sapiens) Other(Other) IF(Mus musculus)