제품 > 항체 > 단일클론항체(mAb)

Galectin 3/LGALS3 Rabbit mAb (A25538)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using Galectin 3/LGALS3 Rabbit mAb (A25538) at 1:9000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - Galectin 3/LGALS3 Rabbit mAb (A25538)

Immunofluorescence analysis of HeLa cells using Galectin 3/LGALS3 Rabbit mAb (A25538) at a dilution of 1:400 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - Galectin 3/LGALS3 Rabbit mAb (A25538)

Immunoprecipitation of Galectin 3/LGALS3 from 300 µg extracts of Hela cells was performed using 3 µg of Galectin 3/LGALS3 Rabbit mAb (A25538). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using Galectin 3/LGALS3 Rabbit mAb (A25538) at 1:10000 dilution.

ABclonal:Flow CytoMetry - Galectin 3/LGALS3 Rabbit mAb (A25538)

Flow cytometry: 1X10^6 Jurkat cells (negative control, left) and MCF7 cells (right) were surface-stained with Galectin 3/LGALS3 Rabbit mAb (A25538, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by FITC conjugated goat anti-Rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 MCF7 cells were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or Galectin 3/LGALS3 Rabbit mAb (A25538, 2 μg/mL, right), followed by FITC conjugated goat anti-Rabbit pAb staining.

Overview

Product name	Galectin 3/LGALS3 Rabbit mAb
Catalog No.	A25538
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC58285

Background

This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human Galectin 3/LGALS3 (NP_002297.2).
Sequence	MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Gene ID
Swiss Prot
Synonyms	L31; GAL3; MAC2; CBP35; GALBP; GALIG; LGALS2
Calculated MW	26kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:9000 - 1:54000 IF/ICC 1:200-1:800 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells FC 1:100 - 1:500 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation Flow Cytometry
Positive samples	HeLa, MCF7, U-87 MG
Cellular location	Cytoplasm, Nucleus, Secreted.