Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates, using AKT2 Rabbit mAb (A24009) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded Human placenta using AKT2 Rabbit mAb (A24009) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat kidney using AKT2 Rabbit mAb (A24009) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Confocal imaging of Jurkat cells using AKT2 Rabbit mAb (A24009, at dilution of 1:200) (Red). DAPI was used for nuclear staining (blue). Objective: 100x.
Confocal imaging of NIH/3T3 cells using AKT2 Rabbit mAb (A24009, at dilution of 1:200) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
| Product name | AKT2 Rabbit mAb |
|---|---|
| Catalog No. | A24009 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC62648 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 390-490 of human AKT2. |
|---|---|
| Sequence | AKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIRE |
| Gene ID | |
| Swiss Prot | |
| Synonyms | PKBB; PRKBB; HIHGHH; PKBBETA; RAC-BETA; AKT2 |
| Calculated MW | 56kDa |
| Observed MW | 60kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | Jurkat, 293T, NIH/3T3, Mouse small intestine (Low expression control), Rat thymus, Rat brain (Low expression control) |
| Cellular location | Cell membrane, Cytoplasm, Early endosome, Nucleus, Peripheral membrane protein. |
| Customer validation | WB(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A24009? Please let us know so that we can cite the reference in this datasheet.
