Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | APP Rabbit pAb |
---|---|
Catalog No. | A11019 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human APP (NP_000475.1). |
---|---|
Sequence | MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKR |
Gene ID | |
Swiss Prot | |
Synonyms | AAA; AD1; PN2; ABPP; APPI; CVAP; ABETA; PN-II; preA4; CTFgamma; alpha-sAPP |
Calculated MW | 87kDa |
Observed MW | 100-140kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | U-87MG |
Cellular location | Membrane, Single-pass type I membrane protein, clathrin-coated pit |
Customer validation | WB(Rattus norvegicus, Mus musculus) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11019? Please let us know so that we can cite the reference in this datasheet.