제품 > 항체 > 단일클론항체(mAb)

β-Amyloid Rabbit mAb (A26342)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Dot-blot analysis of N-terminal peptide of β-Amyloid, β-Amyloid 40 proteins, β-Amyloid 42 proteins using β-Amyloid Rabbit mAb (A26342) at 1:1000 dilution.

ABclonal:Immunohistochemistry - β-Amyloid Rabbit mAb (A26342)

Immunohistochemistry analysis of paraffin-embedded （5XFADJ)Mouse brain and Mouse brain tissue using β-Amyloid Rabbit mAb (A26342) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - β-Amyloid Rabbit mAb (A26342)

Confocal imaging of paraffin-embedded 5XFAD Mouse brain and Mouse brain tissue using β-Amyloid Rabbit mAb (A26342, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Microwave antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining. Objective: 40x.

Overview

Product name	β-Amyloid Rabbit mAb
Catalog No.	A26342
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC65652

Background

This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 591-690 of human β-Amyloid (NP_000475.1).
Sequence	DALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVF
Gene ID
Swiss Prot
Synonyms	AAA; AD1; PN2; ABPP; APPI; CVAP; ABETA; PN-II; preA4; CTFgamma; alpha-sAPP
Calculated MW	87kDa
Observed MW	Refer to figures

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	DB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Immunohistochemistry Immunofluorescence
Positive samples
Cellular location	Membrane, Single-pass type I membrane protein, clathrin-coated pit.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

β-Amyloid Rabbit mAb images

- β-Amyloid Rabbit mAb (A26342)

Dot-blot analysis of N-terminal peptide of β-Amyloid, β-Amyloid 40 proteins, β-Amyloid 42 proteins using β-Amyloid Rabbit mAb (A26342) at 1:1000 dilution.

Immunohistochemistry - β-Amyloid Rabbit mAb (A26342)

Immunofluorescence - β-Amyloid Rabbit mAb (A26342)

* For research use only. Not for therapeutic or diagnostic purposes.