Reviews (1)Publications (4) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | CD14 Rabbit mAb |
---|---|
Catalog No. | A19011 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0353 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CD14 (P08571). |
---|---|
Sequence | QPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVP |
Gene ID | |
Swiss Prot | |
Synonyms | CD14 |
Calculated MW | 40kDa |
Observed MW | 50-65kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence Flow Cytometry |
Positive samples | U-87MG, THP-1, A-549, RAW264.7 |
Cellular location | Cell membrane, GPI-anchor, Lipid-anchor, Secreted. |
Customer validation | (Human PBMCs) IHC(Homo sapiens) WB(Homo sapiens) IF(Mus musculus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A19011? Please let us know so that we can cite the reference in this datasheet.