제품 > 항체 > 단일클론항체(mAb)

CD14 Rabbit mAb (A19011)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of various lysates using CD14 Rabbit mAb (A19011) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunohistochemistry - CD14 Rabbit mAb (A19011)

Immunohistochemistry analysis of paraffin-embedded Human lung cancer using CD14 Rabbit mAb (A19011) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

ABclonal:Immunofluorescence - CD14 Rabbit mAb (A19011)

Confocal imaging of THP-1 cells using CD14 Rabbit mAb (A19011, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of paraffin-embedded Human tonsil using CD14 Rabbit mAb (A19011, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.

ABclonal:Flow CytoMetry - CD14 Rabbit mAb (A19011)

Flow cytometry:1X10^6 Jurkat cells (negative control, left) and A549 cells (right) were surface-stained with CD14 Rabbit mAb(A19011, 10 μg/mL, green line) or Rabbit IgG isotype control (AC042, 10 μg/mL, blue line), followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb(1:600 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).

Review

Overview

Product name	CD14 Rabbit mAb
Catalog No.	A19011
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0353

Background

The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide, and to viruses. This gene has been identified as a target candidate in the treatment of SARS-CoV-2-infected patients to potentially lessen or inhibit a severe inflammatory response. Alternative splicing results in multiple transcript variants encoding the same protein.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CD14 (P08571).
Sequence	QPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVP
Gene ID
Swiss Prot
Synonyms	CD14
Calculated MW	40kDa
Observed MW	50-65kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:200 - 1:800 IF/ICC 1:100 - 1:400 FC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Flow Cytometry
Positive samples	U-87MG, THP-1, A-549, RAW264.7
Cellular location	Cell membrane, GPI-anchor, Lipid-anchor, Secreted.
Customer validation	(Human PBMCs, 293t nci-n87 ht29 ) IHC(Homo sapiens) WB(Homo sapiens) IF(Mus musculus, Homo sapiens)