제품 > 항체 > 단일클론항체(mAb)

CD14 Rabbit mAb (A25089)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 HUVEC cells (negative control, left) and Human PBMC (right) were surface-stained with CD14 Rabbit mAb (A25089, 2 μg/mL, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line), followed by ABflo® 594-conjugated Goat Anti-Rabbit IgG (H+L) staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 Human PBMC cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or CD14 Rabbit mAb (A25089, 2 μg/mL, right).

Overview

Product name	CD14 Rabbit mAb
Catalog No.	A25089
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC65657

Background

The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide, and to viruses. This gene has been identified as a target candidate in the treatment of SARS-CoV-2-infected patients to potentially lessen or inhibit a severe inflammatory response. Alternative splicing results in multiple transcript variants encoding the same protein.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-352 of human CD14 (NP_000582.1).
Sequence	TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPAC
Gene ID
Swiss Prot
Synonyms	CD14
Calculated MW	40kDa
Observed MW	Refer to figures

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Cell membrane, GPI-anchor, Lipid-anchor, Secreted.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CD14 Rabbit mAb images

Flow CytoMetry - CD14 Rabbit mAb (A25089)

Flow cytometry: 1X10^6 Human PBMC cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or CD14 Rabbit mAb (A25089, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.