제품 > 항체 > 단일클론항체(mAb)

CD16b Rabbit mAb (A25539)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from wild type (WT) and 293F cells transfected with CD16b using CD16b Rabbit mAb (A25539) at 1:4000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Flow CytoMetry - CD16b Rabbit mAb (A25539)

Flow cytometry: 1X10^6 293T cells (negative control, left) and 293F (Transfection, right) cells (right) were surface-stained with CD16b Rabbit mAb (A25539, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 293F (Transfection) cells were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or CD16b Rabbit mAb (A25539, 2 μg/mL, right), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining.

Overview

Product name	CD16b Rabbit mAb
Catalog No.	A25539
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC59988

Background

The protein encoded by this gene is a low affinity receptor for the Fc region of gamma immunoglobulins (IgG). The encoded protein acts as a monomer and can bind either monomeric or aggregated IgG. This gene may function to capture immune complexes in the peripheral circulation. Several transcript variants encoding different isoforms have been found for this gene. A highly-similar gene encoding a related protein is also found on chromosome 1.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-208 of human CD16b (NP_000561.3).
Sequence	TEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQ
Gene ID
Swiss Prot
Synonyms	CD16; FCG3; CD16A; CD16b; FCGR3; CD16-I; FCGR3A; FCR-10; FCRIII; FCRIIIb
Calculated MW	26kDa
Observed MW	40-70kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:4000 FC 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Flow Cytometry
Positive samples	293F transfected with CD16b（Human）
Cellular location	Extracellular exosome, extracellular region, plasma membrane