제품 > 항체 > 단일클론항체(mAb)

CD19 Rabbit mAb (A26042)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using CD19 Rabbit mAb (A26042) at a dilution of 1:800 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - CD19 Rabbit mAb (A26042)

Confocal imaging of A20 cells using CD19 Rabbit mAb (A26042, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of Raji cells using CD19 Rabbit mAb (A26042, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of paraffin-embedded Mouse spleen tissue using CD19 Rabbit mAb (A26042, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

ABclonal:Flow CytoMetry - CD19 Rabbit mAb (A26042)

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with CD19 Rabbit mAb (A26042, 2 μg/mL, orange line) or Rabbit IgG isotype control (AC042, 2 μg/mL, blue line), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 C57BL/6 mouse splenocytes were surface-stained with Rabbit IgG isotype control (AC042, 2 μg/mL, left) or CD19 Rabbit mAb (A26042, 2 μg/mL, right), followed by Alexa Fluor® 647 conjugated goat anti-rabbit pAb staining.

Overview

Product name	CD19 Rabbit mAb
Catalog No.	A26042
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC68235

Background

Involved in several processes, including B-1 B cell differentiation; positive regulation of phosphatidylinositol 3-kinase activity; and positive regulation of release of sequestered calcium ion into cytosol. Acts upstream of or within B cell receptor signaling pathway. Located in external side of plasma membrane. Is integral component of plasma membrane. Is expressed in liver and spleen. Human ortholog(s) of this gene implicated in common variable immunodeficiency. Orthologous to human CD19 (CD19 molecule).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 19-287 of mouse CD19 (NP_033974.2).
Sequence	RPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG
Gene ID
Swiss Prot
Synonyms	Cd19
Calculated MW	60kDa
Observed MW	Refer to figures

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:200 - 1:800 IF/ICC 1:200 - 1:800 FC 1:1000 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Immunohistochemistry Immunofluorescence Flow Cytometry
Positive samples
Cellular location	Cell membrane;Membrane raft; Single-pass type I membrane protein.