Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | Caspase-3 Rabbit mAb |
---|---|
Catalog No. | A25309 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC3244 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Caspase-3 (NP_004337.2). |
---|---|
Sequence | INNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRS |
Gene ID | |
Swiss Prot | |
Synonyms | CPP32; SCA-1; CPP32B; Caspase-3 |
Calculated MW | 32kDa |
Observed MW | 32kDa/17, 19kDa/17, 19kDa, 35kDa/17/19/35kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HAP1, HeLa, HeLa |
Cellular location | Cytoplasm. |
Customer validation | WB(Mus musculus, Homo sapiens, Gallus gallus) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A25309? Please let us know so that we can cite the reference in this datasheet.