Review (1)Publications (18) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Caspase-3 Rabbit pAb |
---|---|
Catalog No. | A11319 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 6-105 of human Caspase-3 (NP_004337.2). |
---|---|
Sequence | NSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSK |
Gene ID | |
Swiss Prot | |
Synonyms | CPP32; SCA-1; CPP32B; Caspase-3 |
Calculated MW | 32kDa |
Observed MW | 17kDa/19kDa/32kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Jurkat |
Cellular location | Cytoplasm. |
Customer validation | (ATDC5 cells) WB(Rattus norvegicus, Homo sapiens, Ctenopharyngodon idellus, Mus musculus) IHC(Mus musculus, Homo sapiens, Rattus norvegicus) IF(Mus musculus) IF(Rattus norvegicus) Co-IP(Mus musculus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A11319? Please let us know so that we can cite the reference in this datasheet.