Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | E-Cadherin Rabbit mAb |
---|---|
Catalog No. | A22333 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC51009 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 700-800 of human E-Cadherin (NP_004351.1). |
---|---|
Sequence | PVEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPR |
Gene ID | |
Swiss Prot | |
Synonyms | UVO; CDHE; ECAD; LCAM; Arc-1; BCDS1; CD324; E-Cadherin |
Calculated MW | 97kDa |
Observed MW | 135kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | HCT 116, MCF7, Mouse lung, Mouse liver, Rat kidney |
Cellular location | Cell junction, Cell membrane, Endosome, Golgi apparatus, Single-pass type I membrane protein, trans-Golgi network. |
Customer validation | WB(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22333? Please let us know so that we can cite the reference in this datasheet.