Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Product name | Ubiquitin Rabbit mAb |
---|---|
Catalog No. | A19686 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC50024 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-228 of human Ubiquitin (AAH46123.1). |
---|---|
Sequence | MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG |
Gene ID | |
Swiss Prot | |
Synonyms | HEL-S-50; Ubiquitin |
Calculated MW | 26kDa |
Observed MW | 15-300kDa |
Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% sodium azid, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | HeLa treated by MG132, NIH/3T3 treated by MG132, C6 treated by MG132 |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | IHC(Mus musculus) WB(Mus musculus, Homo sapiens, Rattus norvegicus, Bos taurus) IP(Homo sapiens, Mus musculus) Co-IP(Homo sapiens, Mus musculus) IF(Homo sapiens) IF(Homo sapiens) IF(Homo sapiens) ChIP(Homo sapiens) IP(Homo sapiens) RT-PCR(Homo sapiens) WB(Mus musculus) IP(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19686? Please let us know so that we can cite the reference in this datasheet.