Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | β-Catenin Mouse mAb |
---|---|
Catalog No. | A20221 |
Host species | Mouse |
Purification method | Affinity purification |
Isotype | IgG1, Kappa |
CloneNo. | AMC0440 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human β-Catenin (NP_001895.1). |
---|---|
Sequence | CLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEG |
Gene ID | |
Swiss Prot | |
Synonyms | EVR7; CTNNB; MRD19; NEDSDV; armadillo; β-Catenin |
Calculated MW | 85kDa |
Observed MW | 92kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | A-431, HeLa, Mouse brain, C6 |
Cellular location | Cell junction, Cell membrane, Cytoplasm, Nucleus, adherens junction, centrosome, cytoskeleton, microtubule organizing center, spindle pole. |
Customer validation | WB(Homo sapiens, Mus musculus) IHC(Mus musculus) IP(Homo sapiens,Mus musculus) Other(Homo sapiens,Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A20221? Please let us know so that we can cite the reference in this datasheet.