제품 > 항체 > 단일클론항체(mAb)

Non-phospho (Active)β-Catenin -S33/S37/T41 Rabbit mAb (A22180)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from wild type (WT) and Non-phospho (Active)β-Catenin -S33/S37/T41 knockout (KO) 293T cells using Non-phospho (Active)β-Catenin -S33/S37/T41 Rabbit mAb (A22180) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Western blot analysis of various lysates using Non-phospho (Active)β-Catenin -S33/S37/T41 Rabbit mAb (A22180) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Immunohistochemistry - Non-phospho (Active)β-Catenin -S33/S37/T41 Rabbit mAb (A22180)

Immunohistochemistry analysis of paraffin-embedded Human breast cancer using Non-phospho (Active)β-Catenin -S33/S37/T41 Rabbit mAb (A22180) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using Non-phospho (Active)β-Catenin -S33/S37/T41 Rabbit mAb (A22180) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human tonsil using Non-phospho (Active)β-Catenin -S33/S37/T41 Rabbit mAb (A22180) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Overview

Product name	Non-phospho (Active)β-Catenin -S33/S37/T41 Rabbit mAb
Catalog No.	A22180
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC53641

Background

The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Non-phospho (Active)β-Catenin -S33/S37/T41 (NP_001895.1).
Sequence	MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFP
Gene ID
Swiss Prot
Synonyms	EVR7; CTNNB; MRD19; NEDSDV; armadillo; Non-phospho (Active)β-Catenin -S33/S37/T41
Calculated MW	85kDa
Observed MW	92kDa/92kd

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 IHC-P 1:200 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	293T, Mouse brain, Rat brain, C6
Cellular location	Cell junction, Cell membrane, Cytoplasm, Nucleus, adherens junction, centrosome, cytoskeleton, microtubule organizing center, spindle pole.
Customer validation	WB(Mus musculus, Rattus norvegicus)