Reviews (2)Publications (11) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | β-Catenin Rabbit pAb |
---|---|
Catalog No. | A11512 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 667-781 of human β-Catenin (NP_001895.1). |
---|---|
Sequence | PQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL |
Gene ID | |
Swiss Prot | |
Synonyms | EVR7; CTNNB; MRD19; NEDSDV; armadillo; β-Catenin |
Calculated MW | 85kDa |
Observed MW | 92kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunoprecipitation |
Positive samples | Mouse brain, Mouse lung, C6 |
Cellular location | Cell junction, Cell membrane, Cytoplasm, Nucleus, adherens junction, centrosome, cytoskeleton, microtubule organizing center, spindle pole. |
Customer validation | (Adenocarcinoma human alveolar basal epithelial cells, rat cells) WB(Mus musculus, Danio rerio, Homo sapiens, Rattus norvegicus, Capra hircus, Mus musculus, Gallus gallus) IHC(Homo sapiens,Rattus norvegicus) IF(Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A11512? Please let us know so that we can cite the reference in this datasheet.