Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from HeLa cells using Vinculin Rabbit mAb (A2752) at 1:320000-1:1280000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Confocal imaging of paraffin-embedded Human colon cancer tissue using Vinculin Rabbit mAb (A2752, dilution 1:3200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
| Product name | Vinculin Rabbit mAb |
|---|---|
| Catalog No. | A2752 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC51900 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 800-900 of human Vinculin (NP_054706.1). |
|---|---|
| Sequence | DAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEPDFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMM |
| Gene ID | |
| Swiss Prot | |
| Synonyms | MV; MVCL; CMD1W; CMH15; HEL114; Vinculin |
| Calculated MW | 124kDa |
| Observed MW | 124kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | HeLa |
| Cellular location | Cell junction, Cell membrane, Cytoplasm, Cytoplasmic side, Peripheral membrane protein, adherens junction, cytoskeleton, focal adhesion. |
| Customer validation | WB(Oryctolagus cuniculus, Homo sapiens, Anatinae, Mus musculus, Rattus norvegicus, Mus musculus, Capra hircus) IF(Mus musculus, Homo sapiens) Other(Mus musculus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A2752? Please let us know so that we can cite the reference in this datasheet.
