Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Cleaved GSDMD (N Terminal) Rabbit mAb |
---|---|
Catalog No. | A22523 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC57994 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Cleaved GSDMD (N Terminal) (NP_079012.3). |
---|---|
Sequence | LSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTSEGAWPQLPSGLSMMRCLHNFLTDGVPAEGAFTEDFQGLRAEVETISKE |
Gene ID | |
Swiss Prot | |
Synonyms | DF5L; DFNA5L; FKSG10; GSDMDC1; Cleaved GSDMD (N Terminal) |
Calculated MW | 53kDa |
Observed MW | 30kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | THP-1 treated by TPA and LPS |
Cellular location | cytosol, extracellular region, extracellular space, NLRP3 inflammasome complex, nucleoplasm, plasma membrane. |
Customer validation | IHC(Mus musculus, Rattus norvegicus, Bos taurus) IF(Rattus norvegicus, Homo sapiens, Mus musculus) WB(Rattus norvegicus, Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22523? Please let us know so that we can cite the reference in this datasheet.