Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates, using Cleaved GSDMD (N Terminal) Rabbit mAb (A22523) at 1:800 dilution. THP-1 cells were treated by PMA/TPA (80 nM) at 37℃ for overnight and LPS (1 μg/ml) at 37℃ for 6 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded Human colon using Cleaved GSDMD (N Terminal) Rabbit mAb (A22523) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
| Product name | Cleaved GSDMD (N Terminal) Rabbit mAb |
|---|---|
| Catalog No. | A22523 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC57994 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Cleaved GSDMD (N Terminal) (NP_079012.3). |
|---|---|
| Sequence | LSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTSEGAWPQLPSGLSMMRCLHNFLTDGVPAEGAFTEDFQGLRAEVETISKE |
| Gene ID | |
| Swiss Prot | |
| Synonyms | DF5L; DFNA5L; FKSG10; GSDMDC1; Cleaved GSDMD (N Terminal) |
| Calculated MW | 53kDa |
| Observed MW | 30kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | THP-1 treated by TPA and LPS |
| Cellular location | cytosol, extracellular region, extracellular space, NLRP3 inflammasome complex, nucleoplasm, plasma membrane. |
| Customer validation | IHC(Mus musculus, Rattus norvegicus, Bos taurus) IF(Rattus norvegicus, Homo sapiens, Mus musculus) WB(Rattus norvegicus, Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A22523? Please let us know so that we can cite the reference in this datasheet.
![[KO Validated] Cleaved Gasdermin D (N Terminal) Rabbit mAb](https://img.abclonal.com/abclonal-manage/Catalog/A24059/A24059_1.jpg?t=1731488139)
