Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using Desmin Rabbit mAb (A3736) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded Human stomach tissue using Desmin Rabbit mAb (A3736) at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human smooth muscle tissue using Desmin Rabbit mAb (A3736) at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human prostate cancer tissue using Desmin Rabbit mAb (A3736) at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human thyroid tissue using Desmin Rabbit mAb (A3736) at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human lung tissue using Desmin Rabbit mAb (A3736) at a dilution of 1:1600 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
Immunofluorescence analysis of paraffin-embedded mouse heart using Desmin Rabbit mAb (A3736) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | Desmin Rabbit mAb |
|---|---|
| Catalog No. | A3736 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0235 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 371-470 of human Desmin (P17661). |
|---|---|
| Sequence | EEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CSM1; CSM2; CDCD3; LGMD1D; LGMD1E; LGMD2R; Desmin |
| Calculated MW | 54kDa |
| Observed MW | 54kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | C2C12, RD, Mouse lung, Mouse heart, Rat heart |
| Cellular location | Cell membrane, Cytoplasm, sarcolemma. |
| Customer validation | IHC(Mus musculus, Homo sapiens, Mus musculus, Bos taurus) IF(Homo sapiens, Mus musculus) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3736? Please let us know so that we can cite the reference in this datasheet.
