Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Desmin Rabbit mAb |
---|---|
Catalog No. | A3736 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0235 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 371-470 of human Desmin (P17661). |
---|---|
Sequence | EEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL |
Gene ID | |
Swiss Prot | |
Synonyms | CSM1; CSM2; CDCD3; LGMD1D; LGMD1E; LGMD2R; Desmin |
Calculated MW | 54kDa |
Observed MW | 54kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | C2C12, RD, Mouse lung, Mouse heart, Rat heart |
Cellular location | Cell membrane, Cytoplasm, sarcolemma. |
Customer validation | IHC(Mus musculus, Homo sapiens, Mus musculus, Bos taurus) IF(Homo sapiens, Mus musculus) WB(Mus musculus, Bos taurus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A3736? Please let us know so that we can cite the reference in this datasheet.