Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb |
---|---|
Catalog No. | A21911 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC53510 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-265 of human Heme Oxygenase 1 (HO-1/HMOX1) (NP_002124.1). |
---|---|
Sequence | MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQA |
Gene ID | |
Swiss Prot | |
Synonyms | HO-1; HSP32; HMOX1D; bK286B10; Heme Oxygenase 1 (HO-1/HMOX1) |
Calculated MW | 33kDa |
Observed MW | 33kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | HepG2, HeLa |
Cellular location | Cytoplasmic side, Endoplasmic reticulum membrane, Microsome, Peripheral membrane protein. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.