제품 > 항체 > 단일클론항체(mAb)

Human IgA1 Rabbit mAb (A24333)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from Human plasma using Human IgA1 Rabbit mAb (A24333) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.

ABclonal:Flow CytoMetry - Human IgA1 Rabbit mAb (A24333)

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, left) or Human IgA1 Rabbit mAb(A24333, 2 μg/mL, right).

Overview

Product name	Human IgA1 Rabbit mAb
Catalog No.	A24333
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC60386

Background

Ig alpha is the major immunoglobulin class in body secretions. It may serve both to defend against local infection and to prevent access of foreign antigens to the general immunologic system. In normal adult serum, the approximate percentage composition of IgA with respect to is subclasses is IgA1:90% and IgA2:10%. In secretory IgA, the subclass proportions may approach 50:50. The clinical significance of the subclasses has yet to be determined.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 99-353 of human IgA1.
Sequence	VPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLADWQMPPPYVVLDLPQETLEE
Gene ID
Swiss Prot
Synonyms	IgA1
Calculated MW	42kDa
Observed MW	55kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 FC 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Flow Cytometry
Positive samples	Human plasma
Cellular location	Blood microparticle, extracellular exosome, extracellular region, extracellular space, plasma membrane

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Human IgA1 Rabbit mAb images

Western blot - Human IgA1 Rabbit mAb (A24333)

Flow CytoMetry - Human IgA1 Rabbit mAb (A24333)

Flow cytometry:1X10^6 Human PBMC were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070, 2 μg/mL, left) or Human IgA1 Rabbit mAb(A24333, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.