제품 > 항체 > 단일클론항체(mAb)

PE Rabbit anti-Human IgA1 mAb (A26802)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 Human PBMC were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human IgA1 mAb (A26802, 5 μl/Test, right).Cells in the Lymphocytes gate were used for analysis.

Overview

Product name	PE Rabbit anti-Human IgA1 mAb
Catalog No.	A26802
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC60394-PE

Background

Ig alpha is the major immunoglobulin class in body secretions. It may serve both to defend against local infection and to prevent access of foreign antigens to the general immunologic system. In normal adult serum, the approximate percentage composition of IgA with respect to is subclasses is IgA1:90% and IgA2:10%. In secretory IgA, the subclass proportions may approach 50:50. The clinical significance of the subclasses has yet to be determined.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 99-353 of human IgA1.
Sequence	VPCPVPSTPPTPSPSTPPTPSPSCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLADWQMPPPYVVLDLPQETLEE
Gene ID
Swiss Prot
Synonyms	IgA1
Calculated MW	38kDa/42KDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer	Store at 2-8℃. Avoid freeze. Buffer: PBS with 0.09% Sodium azide, 0.2% BSA, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Blood microparticle, extracellular exosome, extracellular region, extracellular space, plasma membrane.