Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | IκBα Rabbit mAb |
---|---|
Catalog No. | A19714 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0194 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IκBα (P25963). |
---|---|
Sequence | MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGD |
Gene ID | |
Swiss Prot | |
Synonyms | IKBA; MAD-3; NFKBI; EDAID2; IκBα |
Calculated MW | 36kDa |
Observed MW | 35kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | MCF7, NIH/3T3 |
Cellular location | Cytoplasm, Nucleus. |
Customer validation | WB(Homo sapiens, Mus musculus, Rattus norvegicus, Cyprinus carpio, Mus musculus, Sus scrofa, Other) IF(Rattus norvegicus) Co-IP(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19714? Please let us know so that we can cite the reference in this datasheet.