제품 > 항체 > 단일클론항체(mAb)

IFN gamma Rabbit mAb (A23152)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of Recombinant Rat IFN-gamma Protein (RP01075), using IFN gamma Rabbit mAb (A23152) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 1ng/0.5ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 120s.

Western blot analysis of Recombinant Mouse IFN-gamma Protein (RP01070), using IFN gamma Rabbit mAb (A23152) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 1ng/0.5ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 120s.

Overview

Product name	IFN gamma Rabbit mAb
Catalog No.	A23152
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC57549

Background

Predicted to enable cytokine activity. Involved in several processes, including negative regulation of cell population proliferation; positive regulation of NMDA glutamate receptor activity; and positive regulation of macromolecule metabolic process. Located in several cellular components, including extracellular space; neuron projection; and perikaryon. Used to study several diseases, including Chagas disease; allergic conjunctivitis; allergic rhinitis; renal fibrosis; and ureteral obstruction. Biomarker of several diseases, including abdominal aortic aneurysm; autoimmune thyroiditis; pulpitis; tongue squamous cell carcinoma; and visual epilepsy. Human ortholog(s) of this gene implicated in several diseases, including ataxia telangiectasia; autoimmune disease (multiple); eczema herpeticum; factor VIII deficiency; and leukemia (multiple). Orthologous to human IFNG (interferon gamma).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-153 of rat IFN gamma (NP_620235.1).
Sequence	CYCQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKR
Gene ID
Swiss Prot
Synonyms	If2f; IFNG2; IFN gamma
Calculated MW	18kDa
Observed MW	50-55kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Recombinant Mouse/Rat IFN-gamma Protein
Cellular location
Customer validation	WB(Rattus norvegicus, Mus musculus) FC(Homo sapiens)