제품 > 항체 > 단일클론항체(mAb)

[KD Validated] Proprotein Convertase 9(PCSK9) Rabbit mAb (A11532)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from HepG2 cells, using [KD Validated] Proprotein Convertase 9(PCSK9) Rabbit mAb (A11532) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Western blot analysis of lysates from wild type(WT) and Proprotein Convertase 9(PCSK9) knockdown (KD) HeLa cells, using Proprotein Convertase 9(PCSK9) Rabbit mAb (A11532) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Overview

Product name	[KD Validated] Proprotein Convertase 9(PCSK9) Rabbit mAb
Catalog No.	A11532
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC50558

Background

This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an autocatalytic processing event with its prosegment in the ER and is constitutively secreted as an inactive protease into the extracellular matrix and trans-Golgi network. It is expressed in liver, intestine and kidney tissues and escorts specific receptors for lysosomal degradation. It plays a role in cholesterol and fatty acid metabolism. Mutations in this gene have been associated with autosomal dominant familial hypercholesterolemia. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 593-692 of human Proprotein Convertase 9(PCSK9) (NP_777596.2).
Sequence	EASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ
Gene ID
Swiss Prot
Synonyms	FH3; PC9; FHCL3; NARC1; LDLCQ1; NARC-1; HCHOLA3; [KD Validated] Proprotein Convertase 9(PCSK9)
Calculated MW	74kDa
Observed MW	65kDa/80kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, HepG2
Cellular location	Cell surface, Cytoplasm, Endoplasmic reticulum, Endosome, Golgi apparatus, Lysosome, Secreted.