Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using Proprotein Convertase 9(PCSK9) Rabbit pAb (A7860) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Western blot analysis of lysates from Mouse liver, using Proprotein Convertase 9(PCSK9) Rabbit pAb (A7860) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using Proprotein Convertase 9(PCSK9) Rabbit pAb (A7860) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using Proprotein Convertase 9(PCSK9) Rabbit pAb (A7860) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using Proprotein Convertase 9(PCSK9) Rabbit pAb (A7860) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Proprotein Convertase 9(PCSK9) Rabbit pAb (A7860) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of HepG2 cells using Proprotein Convertase 9(PCSK9) Rabbit pAb (A7860) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using Proprotein Convertase 9(PCSK9) Rabbit pAb (A7860) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using Proprotein Convertase 9(PCSK9) Rabbit pAb (A7860) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using Proprotein Convertase 9(PCSK9) Rabbit pAb (A7860) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunoprecipitation of Proprotein Convertase 9(PCSK9) from 200 µg extracts of HeLa cells was performed using 0.5 µg of Proprotein Convertase 9(PCSK9) Rabbit pAb (A7860). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using Proprotein Convertase 9(PCSK9) Rabbit pAb (A7860) at a dilution of 1:1000.
| Product name | Proprotein Convertase 9(PCSK9) Rabbit pAb |
|---|---|
| Catalog No. | A7860 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 590-692 of human Proprotein Convertase 9(PCSK9) (NP_777596.2). |
|---|---|
| Sequence | GHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ |
| Gene ID | |
| Swiss Prot | |
| Synonyms | FH3; PC9; FHCL3; NARC1; LDLCQ1; NARC-1; HCHOLA3; Proprotein Convertase 9(PCSK9) |
| Calculated MW | 74kDa |
| Observed MW | 80kDa/65kDa, |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
| Positive samples | HeLa, Mouse liver, Rat liver, Rat testis, HeLa |
| Cellular location | Cell surface, Cytoplasm, Endoplasmic reticulum, Endosome, Golgi apparatus, Lysosome, Secreted. |
| Customer validation | WB(Mus musculus, Homo sapiens) IF(Mus musculus) IHC(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A7860? Please let us know so that we can cite the reference in this datasheet.
![[KD Validated] Proprotein Convertase 9(PCSK9) Rabbit mAb](https://img.abclonal.com/abclonal-manage/Catalog/A11532/A11532_1.jpg?t=1725348552)
