Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | [KO Validated] FGFR2 Rabbit mAb |
---|---|
Catalog No. | A19051 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0480 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGFR2 (P21802). |
---|---|
Sequence | MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPR |
Gene ID | |
Swiss Prot | |
Synonyms | BEK; JWS; BBDS; CEK3; CFD1; ECT1; KGFR; TK14; TK25; BFR-1; CD332; K-SAM; R2 |
Calculated MW | 92kDa |
Observed MW | 145kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | 293T, A-431, Mouse brain, Mouse lung, Rat brain, Rat lung |
Cellular location | Cell membrane, Cytoplasmic vesicle, Golgi apparatus, Secreted, Single-pass type I membrane protein. |
Customer validation | WB(Homo sapiens, Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A19051? Please let us know so that we can cite the reference in this datasheet.