제품 > 항체 > 다중클론항체(pAb)

[KO Validated] NG2/CSPG4 Rabbit pAb (A3592)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from A375 cells, using [KO Validated] NG2/CSPG4 Rabbit pAb (A3592) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of various lysates using [KO Validated] NG2/CSPG4 Rabbit pAb (A3592) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Western blot analysis of lysates from wild type (WT) and NG2/CSPG4 knockout (KO) HeLa cells, using [KO Validated] NG2/CSPG4 Rabbit pAb (A3592) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	[KO Validated] NG2/CSPG4 Rabbit pAb
Catalog No.	A3592
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

A human melanoma-associated chondroitin sulfate proteoglycan plays a role in stabilizing cell-substratum interactions during early events of melanoma cell spreading on endothelial basement membranes. CSPG4 represents an integral membrane chondroitin sulfate proteoglycan expressed by human malignant melanoma cells.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1340-1563 of human NG2/CSPG4 (NP_001888.2).
Sequence	LGAPLEGVLVELEVLPAAIPLEAQNFSVPEGGSLTLAPPLLRVSGPYFPTLLGLSLQVLEPPQHGALQKEDGPQARTLSAFSWRMVEEQLIRYVHDGSETLTDSFVLMANASEMDRQSHPVAFTVTVLPVNDQPPILTTNTGLQMWEGATAPIPAEALRSTDGDSGSEDLVYTIEQPSNGRVVLRGAPGTEVRSFTQAQLDGGLVLFSHRGTLDGGFRFRLSDG
Gene ID
Swiss Prot
Synonyms	NG2; MCSP; MCSPG; MSK16; CSPG4A; HMW-MAA; MEL-CSPG; G4
Calculated MW	251kDa
Observed MW	250kDa-450kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, A375, Mouse heart, Rat brain, Rat heart
Cellular location	Apical cell membrane, Cell projection, Extracellular side, Single-pass type I membrane protein, lamellipodium membrane
Customer validation	IF(Mus musculus) WB(Homo sapiens, Mus musculus) IF(Mus musculus)