제품 > 항체 > 단일클론항체(mAb)

beta 2 Microglobulin Rabbit mAb (A11642)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using beta 2 Microglobulin Rabbit mAb (A11642)at 1:3000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): Daudi
Exposure time: 10s.

ABclonal:Immunohistochemistry - beta 2 Microglobulin Rabbit mAb (A11642)

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using beta 2 Microglobulin Rabbit mAb (A11642) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using beta 2 Microglobulin Rabbit mAb (A11642) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Review

Overview

Product name	beta 2 Microglobulin Rabbit mAb
Catalog No.	A11642
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0656

Background

This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fibrils in some pathological conditions. The encoded antimicrobial protein displays antibacterial activity in amniotic fluid. A mutation in this gene has been shown to result in hypercatabolic hypoproteinemia.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 40-119 of human beta 2 Microglobulin (P61769).
Sequence	SNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Gene ID
Swiss Prot
Synonyms	IMD43; beta 2 Microglobulin
Calculated MW	14kDa
Observed MW	12kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:3000 - 1:18000 IHC-P 1:1000 - 1:5000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	THP-1, HeLa, Mouse lung, Mouse liver, Rat liver, Rat lung
Cellular location	Secreted.
Customer validation	(Hela 、RPMI-8226 、HepG2 、EFE-184 、Pfeiffer, Hela RPMI-8226 HepG2 T47D EFE-184 Pfeiffer PEO)