제품 > 항체 > 다중클론항체(pAb)

[KO Validated] Peroxiredoxin 4 (PRDX4) Rabbit pAb (A1486)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using Peroxiredoxin 4 (Peroxiredoxin 4 (PRDX4)) antibody (A1486) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

Western blot analysis of extracts from normal (control) and Peroxiredoxin 4 (Peroxiredoxin 4 (PRDX4)) knockout (KO) 293T cells, using Peroxiredoxin 4 (Peroxiredoxin 4 (PRDX4)) antibody (A1486) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Overview

Product name	[KO Validated] Peroxiredoxin 4 (PRDX4) Rabbit pAb
Catalog No.	A1486
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 38-271 of human Peroxiredoxin 4 (Peroxiredoxin 4 (PRDX4)) (NP_006397.1).
Sequence	WETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
Gene ID
Swiss Prot
Synonyms	PRX-4; AOE372; AOE37-2; HEL-S-97n
Calculated MW	31kDa
Observed MW	28kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	H460, PC-3, HeLa, MCF-7, Mouse testis
Cellular location	Cytoplasm, Secreted