제품 > 항체 > 단일클론항체(mAb)

Peroxiredoxin 4 (PRDX4) Rabbit mAb (A9131)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Peroxiredoxin 4 (PRDX4) (PRDX4) Rabbit mAb (A9131) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunohistochemistry - Peroxiredoxin 4 (PRDX4) Rabbit mAb (A9131)

Immunohistochemistry analysis of Peroxiredoxin 4 (PRDX4) in paraffin-embedded human thyroid cancer tissue using Peroxiredoxin 4 (PRDX4) Rabbit mAb (A9131) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Peroxiredoxin 4 (PRDX4) in paraffin-embedded human colon carcinoma tissue using Peroxiredoxin 4 (PRDX4) Rabbit mAb (A9131) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Peroxiredoxin 4 (PRDX4) in paraffin-embedded mouse testis tissue using Peroxiredoxin 4 (PRDX4) Rabbit mAb (A9131) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Peroxiredoxin 4 (PRDX4) in paraffin-embedded human lung cancer tissue using Peroxiredoxin 4 (PRDX4) Rabbit mAb (A9131) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Peroxiredoxin 4 (PRDX4) in paraffin-embedded rat colon tissue using Peroxiredoxin 4 (PRDX4) Rabbit mAb (A9131) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Peroxiredoxin 4 (PRDX4) in paraffin-embedded human liver tissue using Peroxiredoxin 4 (PRDX4) Rabbit mAb (A9131) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of Peroxiredoxin 4 (PRDX4) in paraffin-embedded human cervix cancer tissue using Peroxiredoxin 4 (PRDX4) Rabbit mAb (A9131) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - Peroxiredoxin 4 (PRDX4) Rabbit mAb (A9131)

Immunofluorescence analysis of NIH-3T3 cells using Peroxiredoxin 4 (PRDX4) (PRDX4) Rabbit mAb (A9131) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Peroxiredoxin 4 (PRDX4) Rabbit mAb
Catalog No.	A9131
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1442

Background

The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Peroxiredoxin 4 (PRDX4) (PRDX4) (Q13162).
Sequence	MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKE
Gene ID
Swiss Prot
Synonyms	PRX-4; AOE372; AOE37-2; HEL-S-97n; Peroxiredoxin 4 (PRDX4)
Calculated MW	31kDa
Observed MW	27kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Jurkat, U-251MG, Mouse liver, Rat lung
Cellular location	Cytoplasm, Secreted