제품 > 항체 > 다중클론항체(pAb)

Peroxiredoxin 4 (PRDX4) Rabbit pAb (A18308)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Peroxiredoxin 4 (Peroxiredoxin 4 (PRDX4)) Rabbit pAb (A18308) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Peroxiredoxin 4 (PRDX4) Rabbit pAb (A18308)

Immunohistochemistry analysis of paraffin-embedded rat liver using Peroxiredoxin 4 (PRDX4) Rabbit pAb (A18308) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human liver cancer using Peroxiredoxin 4 (PRDX4) Rabbit pAb (A18308) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse kidney using Peroxiredoxin 4 (PRDX4) Rabbit pAb (A18308) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Peroxiredoxin 4 (PRDX4) Rabbit pAb (A18308)

Immunofluorescence analysis of NIH/3T3 cells using Peroxiredoxin 4 (PRDX4) Rabbit pAb (A18308) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Peroxiredoxin 4 (PRDX4) Rabbit pAb
Catalog No.	A18308
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is an antioxidant enzyme and belongs to the peroxiredoxin family. The protein is localized to the cytoplasm. Peroxidases of the peroxiredoxin family reduce hydrogen peroxide and alkyl hydroperoxides to water and alcohol with the use of reducing equivalents derived from thiol-containing donor molecules. This protein has been found to play a regulatory role in the activation of the transcription factor NF-kappaB.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 10-110 of human Peroxiredoxin 4 (PRDX4) (NP_006397.1).
Sequence	TTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKY
Gene ID
Swiss Prot
Synonyms	PRX-4; AOE372; AOE37-2; HEL-S-97n; Peroxiredoxin 4 (PRDX4)
Calculated MW	31kDa
Observed MW	30kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HepG2, U-251MG, BxPC-3, Mouse brain, Rat brain, Rat liver
Cellular location	Cytoplasm, Secreted
Customer validation	WB(Mus musculus)