Review (1)Publications (16) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Western blot analysis of lysates from U-937 cells, using LAMP1 Rabbit pAb (A2582) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of lysates from wild type(WT) and LAMP1 knockout (KO) HeLa cells, using LAMP1 Rabbit pAb (A2582) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
| Product name | LAMP1 Rabbit pAb |
|---|---|
| Catalog No. | A2582 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human LAMP1 (NP_005552.3). |
|---|---|
| Sequence | DKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNT |
| Gene ID | |
| Swiss Prot | |
| Synonyms | LAMPA; CD107a; LGP120; LAMP1 |
| Calculated MW | 45kDa |
| Observed MW | 90-120kDa |
| Reactivity | Human |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | U-937, HeLa |
| Cellular location | Cell membrane, Endosome membrane, Late endosome, Lysosome membrane, Single-pass type I membrane protein. |
| Customer validation | (HEK293T) WB(Mus musculus, Homo sapiens, Rattus norvegicus, Sus scrofa) IF(Homo sapiens, Rattus norvegicus, Sus scrofa) IHC(Mus musculus) IF(Homo sapiens, Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A2582? Please let us know so that we can cite the reference in this datasheet.
![[KD Validated] LAMP1 Rabbit pAb](https://img.abclonal.com/abclonal-manage/Catalog/A16894/A16894_1.jpg?t=1731290904)
![[KD Validated] LAMP1/CD107a Rabbit mAb](https://img.abclonal.com/abclonal-manage/Catalog/A21194/A21194_1.jpg?t=1726630489)
i_FC_01.jpg?t=1704935975)
i_FC_01.jpg?t=1704936243)
i_FC_01.jpg?t=1709082318)
